Skip to content

feat(alphafold): custom MSA input for monomer and multimer predictions (#52) - #235

Open
Elarwei001 wants to merge 3 commits into
scverse:devfrom
Elarwei001:feature/alphafold-custom-msa-52
Open

feat(alphafold): custom MSA input for monomer and multimer predictions (#52)#235
Elarwei001 wants to merge 3 commits into
scverse:devfrom
Elarwei001:feature/alphafold-custom-msa-52

Conversation

@Elarwei001

@Elarwei001 Elarwei001 commented Jun 24, 2026

Copy link
Copy Markdown
Contributor

Resolves #52

Summary

gget alphafold: Adds a new msa argument (-msa/--msa on the command line) that lets you supply a custom multiple sequence alignment instead of running the internal jackhmmer search. When an MSA is provided, gget alphafold skips the jackhmmer search entirely, so no genetic databases are downloaded (the internal search otherwise fetches ~2 GB) — useful for folding from a manually curated MSA.

Originally scoped to monomers (issue #52); this PR also extends the feature to MULTIMER predictions (one MSA file per chain).

What it does

  • Monomer: pass a single MSA file.
  • Multimer: pass one MSA file per chain, in the same order as the input sequences. The first sequence in each chain's MSA must be that chain's query (matching the input sequence, ignoring gaps).
  • Accepts a3m (.a3m) and aligned FASTA (.fasta / .fa / .afa). a3m lowercase insertions are parsed into the deletion matrix (matching AlphaFold's own a3m handling); aligned FASTA has no insertions, so its deletion matrix is all zeros.
  • The multimer path reuses AlphaFold-Multimer's existing cross-chain MSA pairing — each chain's custom MSA is also used as its all_seq MSA, which Multimer pairs across chains by species. Pairing only finds matches when the MSA headers carry species identifiers; otherwise it degrades gracefully to an unpaired multimer.

Implementation notes

  • New validation helper _validate_custom_msa_paths(custom_msa_paths, sequences) enforces, before any prediction work:
    1. file count == number of chains,
    2. each file exists,
    3. each file has a supported extension,
    4. the first sequence in each chain's MSA equals that chain's query (gaps removed, case-insensitive).
  • Supporting helpers: detect_msa_format, parse_custom_msa (a3m/FASTA → aligned sequences + deletion matrix + descriptions), and read_custom_msa (returns an alphafold.data.parsers.Msa).
  • The jackhmmer branch (closest-source lookup, DB list, binary chmod, per-chain search) is now gated behind msa is None and left otherwise unchanged.
  • CLI --msa uses nargs="+" so it accepts one or more files (one per chain); main.py forwards args.msa to alphafold(...).

Testing

Unit / validation tests added in tests/test_alphafold.py (with a3m + aligned-FASTA fixtures in tests/fixtures/), covering format detection, a3m/FASTA parsing and deletion-matrix behavior, the CLI --msa flag, and the monomer + multimer validation cases (count mismatch, query mismatch, missing file). These pass. AlphaFold's heavy runtime deps aren't available in CI, so tests run at the parsing/validation level; a full GPU end-to-end fold is in progress and not yet complete.

Docs

  • docs/src/en/alphafold.md — documents the -msa/--msa argument.
  • docs/src/en/updates.md — changelog entry.

Resolves issue 52.

@codecov-commenter

codecov-commenter commented Jun 24, 2026

Copy link
Copy Markdown

Codecov Report

❌ Patch coverage is 48.24561% with 59 lines in your changes missing coverage. Please review.
✅ Project coverage is 57.16%. Comparing base (e43a804) to head (68324d5).
⚠️ Report is 2 commits behind head on dev.

Files with missing lines Patch % Lines
gget/gget_alphafold.py 48.24% 59 Missing ⚠️
Additional details and impacted files
@@            Coverage Diff             @@
##              dev     #235      +/-   ##
==========================================
+ Coverage   56.70%   57.16%   +0.45%     
==========================================
  Files          29       29              
  Lines        9392     9468      +76     
==========================================
+ Hits         5326     5412      +86     
+ Misses       4066     4056      -10     

☔ View full report in Codecov by Harness.
📢 Have feedback on the report? Share it here.

🚀 New features to boost your workflow:
  • ❄️ Test Analytics: Detect flaky tests, report on failures, and find test suite problems.

@Elarwei001
Elarwei001 marked this pull request as draft June 25, 2026 03:44
@lauraluebbert
lauraluebbert deleted the branch scverse:dev June 28, 2026 20:31
@lauraluebbert lauraluebbert reopened this Jun 28, 2026
Add an `msa` parameter (Python) / -msa, --msa flag (CLI) to gget
alphafold that lets users supply a custom multiple sequence alignment
(a3m or aligned FASTA) instead of running the internal jackhmmer search.
The first sequence in the MSA must be the query.

When a custom MSA is provided, gget skips the jackhmmer search and the
genetic-database download entirely and builds the MSA features directly
from the file. New helpers detect_msa_format()/parse_custom_msa()/
read_custom_msa() handle format detection and a3m/FASTA parsing
(lowercase a3m insertions are folded into the deletion matrix, matching
AlphaFold's own parser). Currently supported for single-sequence
(monomer) predictions; clear errors are raised otherwise. Default
behavior is unchanged (backward compatible).

Resolves scverse#52.

Co-Authored-By: Claude Opus 4.8 (1M context) <noreply@anthropic.com>
@lauraluebbert
lauraluebbert force-pushed the feature/alphafold-custom-msa-52 branch from 22b4993 to 1de9260 Compare June 29, 2026 00:41
Elarwei001 added a commit to Elarwei001/gget_issues that referenced this pull request Jul 7, 2026
Bilingual (ZH/EN) analysis of scverse/gget#235 (adds an msa argument to
gget alphafold: supply a custom a3m/FASTA MSA, skip the jackhmmer search and
the ~2GB database download). Covers platform fit (enhance an existing module),
the a3m parsing that faithfully reproduces AlphaFold's own parse_a3m, the
reproducibility gain, the CI-constrained parsing-level tests, and the
pre-commit.ci red root cause (a single mypy narrowing at gget_alphafold.py:712).
Updated README index + index.html card.

Co-Authored-By: Claude Opus 4.8 (1M context) <noreply@anthropic.com>
Elarwei001 and others added 2 commits July 7, 2026 20:38
…xing (scverse#52)

`custom_msa_paths` is assigned a list inside an earlier `if msa is not None:`
block, so at the fold loop mypy still sees it as `list[str] | None` and rejects
the indexing (the pre-commit.ci mypy failure). Guard on `custom_msa_paths is not
None` (equivalent to `msa is not None`) so the type narrows.

Co-Authored-By: Claude Opus 4.8 (1M context) <noreply@anthropic.com>
)

Extends the custom-MSA input to multimer: pass one MSA file per chain (in the
same order as the sequences) instead of the previous monomer-only restriction.

- Extract the per-chain validation into a testable `_validate_custom_msa_paths`
  helper: one MSA file per chain, each file's format checked, and each chain's
  first MSA sequence must equal that chain's query (gaps removed).
- For heteromer multimer, the custom MSA also serves as the "all_seq" MSA that
  AlphaFold-Multimer pairs across chains by species (reuses the existing
  msa_pairing / pipeline_multimer path); pairing degrades gracefully to unpaired
  when headers lack species identifiers.
- CLI `--msa` now accepts multiple files (nargs="+").
- Tests for the validation helper (monomer/multimer OK, count mismatch, per-chain
  query mismatch, missing file). The fold/pairing path itself still cannot be
  exercised in CI (AlphaFold's heavy deps/GPU are unavailable); it reuses
  AlphaFold's own multimer feature pipeline unchanged.

Co-Authored-By: Claude Opus 4.8 (1M context) <noreply@anthropic.com>
@Elarwei001 Elarwei001 changed the title feat(alphafold): accept a user-provided custom MSA input (#52) feat(alphafold): custom MSA input for monomer and multimer predictions (#52) Jul 7, 2026
@Elarwei001

Copy link
Copy Markdown
Contributor Author

End-to-end verification of the multimer custom-MSA path

The unit tests here cover the argument / parsing / validation layer (which is all CI can run, since AlphaFold's heavy runtime deps aren't available). To cover the part CI can't, I ran a full GPU fold of the new multimer path on a rented CUDA GPU. It passes end-to-end.

Environment

GPU NVIDIA RTX 6000 Ada (48 GB), Python 3.12
jax / jaxlib 0.4.26 / 0.4.26 (cuda12), jax.devices() == [cuda(id=0)]
AlphaFold params Colab set, incl. params_model_{1..5}_multimer_v3.npz

Test case — a real small heterodimer: human insulin A chain (21 aa) + B chain (30 aa). Each chain gets a custom a3m whose first sequence is that chain's query, plus three species-tagged homologs (headers use the UniProt db|ACC|ENTRY_SPECIES form that AlphaFold's msa_identifiers parses for cross-chain pairing).

gget.alphafold(
    ["GIVEQCCTSICSLYQLENYCN", "FVNQHLCGSHLVEALYLVCGERGFFYTPKT"],
    msa=["chainA.a3m", "chainB.a3m"],
    relax=False, plot=False,
)

Run log (key lines)

Using the multimer model with 2 sequences.
Using 2 user-provided custom MSA file(s); skipping the internal jackhmmer search.
3 unique sequences found in the custom MSA for sequence 1.
3 unique sequences found in the custom MSA for sequence 2.
Running model_1_multimer_v3 ... model_5_multimer_v3   (all 5 completed)

Result — a valid two-chain complex + PAE:

  • selected_prediction.pdb — 2 chains, 2 TER records, 51 CA atoms = 21 + 30 residues, matching insulin A + B.
  • predicted_aligned_error.json — PAE matrix.

So the new path (_validate_custom_msa_paths → per-chain read_custom_msauniprot_msa = custom_msa, reusing AlphaFold-Multimer's cross-chain pairing) runs end-to-end and produces a real prediction. Fold quality isn't the point — the MSA is intentionally shallow/partly synthetic to exercise the pipeline cheaply.

Full artifacts (inputs, driver, run log, output PDB + PAE, environment snapshot): https://gist.github.com/Elarwei001/0e342e4e76997c7d07553279f778d5a8


One side note from setting this up: getting AlphaFold to actually install/import currently needs a couple of workarounds that are unrelated to this PR (they're in the gget setup alphafold path against the current deepmind/alphafold main). I filed those separately in #264 so they don't muddy this PR.

@Elarwei001

Copy link
Copy Markdown
Contributor Author

End-to-end verification — monomer path

Following up on the multimer run above: I also verified the monomer custom-MSA path end-to-end on a GPU (the original issue #52 case — a single sequence with a single MSA, passing msa as a string rather than a list, which exercises the monomer branch specifically).

Environment — RTX A6000 (48 GB), Python 3.12, jax 0.4.26 (cuda12), jax.devices() == [cuda(id=0)].

Test case — human insulin B chain (30 aa) with a single custom a3m (query + 3 homologs):

gget.alphafold(
    "FVNQHLCGSHLVEALYLVCGERGFFYTPKT",
    msa="chainM.a3m",          # single string, not a list
    relax=False, plot=False,
)

Run log (key lines)

Using 1 user-provided custom MSA file(s); skipping the internal jackhmmer search.
4 unique sequences found in the custom MSA for sequence 1.
Running model_1 ... model_5, model_2_ptm   (all completed on GPU)
Running model without relaxation stage.
=== FOLD_RETURNED ===

Resultselected_prediction.pdb: single chain A, 30 CA atoms = 30 residues (matching insulin B), 1 TER, first residue PHE A 1; plus predicted_aligned_error.json. So the monomer branch (msa string → single-chain read_custom_msa → monomer feature pipeline, no cross-chain pairing) runs end-to-end and produces a real single-chain prediction.

Artifacts (monomer inputs, driver, run log, output PDB + PAE, environment snapshot) are in the same gist as the multimer run, under the monomer_* / chainM.a3m / run_mono.py files: https://gist.github.com/Elarwei001/0e342e4e76997c7d07553279f778d5a8

With this, both paths added in this PR are verified end-to-end on a real GPU: multimer (one MSA per chain) and monomer (single MSA).

@Elarwei001

Copy link
Copy Markdown
Contributor Author

Hi @lauraluebbert , when you get a chance, could you take a look at #235? Quick summary:

  1. What it adds — a msa argument (--msa) to gget alphafold that takes a custom MSA and skips the internal jackhmmer search entirely (so no genetic databases are downloaded). Resolves [gget_alphafold] - Feature Request - Add an option to submit a MSA instead of a protein sequence #52.
  2. Monomer + multimer — a monomer takes one MSA file; a multimer takes one per chain (in sequence order). The first sequence in each chain's MSA must be that chain's query. The multimer path reuses AlphaFold-Multimer's own cross-chain pairing.
  3. Testing — unit tests cover the parsing/validation layer (all CI can run). I also ran both paths end-to-end on a GPU (insulin monomer, and insulin A+B heterodimer); results and artifacts are in two comments on the PR.
  4. Unrelated heads-up — while setting that up I hit two pre-existing breakages in the gget setup alphafold path (not from this PR); filed separately as gget setup alphafold / gget alphafold break against the current deepmind/alphafold main branch #264.

Thanks!

@Elarwei001
Elarwei001 marked this pull request as ready for review July 8, 2026 01:21
Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment

Labels

None yet

Projects

None yet

Development

Successfully merging this pull request may close these issues.

3 participants